292908

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 39175..39664 Replicon plasmid 5
Accession NZ_LS992189
Organism Escherichia coli isolate Escherichia coli str. 3426

Toxin (Protein)


Gene name TsxA Uniprot ID U3PL64
Locus tag EC3426_RS26585 Protein ID WP_020314676.1
Coordinates 39404..39664 (-) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag EC3426_RS26580 Protein ID WP_022540736.1
Coordinates 39175..39414 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EC3426_RS26520 34211..34918 + 708 WP_000108796.1 hypothetical protein -
EC3426_RS26525 34938..35357 + 420 WP_001708405.1 hypothetical protein -
EC3426_RS26530 35359..35622 + 264 WP_000224227.1 hypothetical protein -
EC3426_RS26535 35659..35837 + 179 Protein_37 hypothetical protein -
EC3426_RS26545 36171..36491 + 321 WP_133963906.1 hypothetical protein -
EC3426_RS26550 36622..37059 - 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
EC3426_RS26555 37084..37266 - 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
EC3426_RS26560 37811..37993 + 183 WP_001401700.1 hypothetical protein -
EC3426_RS26565 38380..38640 - 261 WP_020314977.1 hypothetical protein -
EC3426_RS26580 39175..39414 - 240 WP_022540736.1 transcriptional regulator Antitoxin
EC3426_RS26585 39404..39664 - 261 WP_020314676.1 hypothetical protein Toxin
EC3426_RS26590 39716..39940 - 225 WP_000814381.1 hypothetical protein -
EC3426_RS26595 40037..40246 - 210 WP_020314678.1 hypothetical protein -
EC3426_RS26600 40289..40612 - 324 WP_020314677.1 hypothetical protein -
EC3426_RS26610 41193..41435 - 243 WP_000151456.1 hypothetical protein -
EC3426_RS26615 41432..41686 - 255 WP_001230709.1 hypothetical protein -
EC3426_RS26620 41683..42225 - 543 WP_001083904.1 hypothetical protein -
EC3426_RS26625 42329..42844 - 516 WP_001025393.1 J domain-containing protein -
EC3426_RS26630 43248..43577 - 330 WP_001542022.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..64687 64687


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9922.30 Da        Isoelectric Point: 7.2028

>T292908 WP_020314676.1 NZ_LS992189:c39664-39404 [Escherichia coli]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEKAFDTIDFASDGLRDNDKEIVFMMIQEMS
EEENAN

Download         Length: 261 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 9072.61 Da        Isoelectric Point: 10.2613

>AT292908 WP_022540736.1 NZ_LS992189:c39414-39175 [Escherichia coli]
MLTENTPENIKRLRKKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKYLLLLAGEHPEYVLSKRDRGILK

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A376MG86

Antitoxin

Source ID Structure

References