Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3634480..3635100 Replicon chromosome
Accession NZ_LS992183
Organism Citrobacter freundii isolate Citrobacter freundii str. U2785

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag CFU2785_RS18230 Protein ID WP_002892050.1
Coordinates 3634882..3635100 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID R8WZW8
Locus tag CFU2785_RS18225 Protein ID WP_003021733.1
Coordinates 3634480..3634854 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CFU2785_RS18215 3629626..3630819 + 1194 WP_003835922.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
CFU2785_RS18220 3630842..3633991 + 3150 WP_003021736.1 multidrug efflux RND transporter permease subunit -
CFU2785_RS18225 3634480..3634854 + 375 WP_003021733.1 Hha toxicity modulator TomB Antitoxin
CFU2785_RS18230 3634882..3635100 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
CFU2785_RS18235 3635407..3635958 + 552 WP_134216077.1 maltose O-acetyltransferase -
CFU2785_RS18240 3636075..3636545 + 471 WP_003021724.1 YlaC family protein -
CFU2785_RS18245 3636624..3636764 - 141 WP_005125190.1 type B 50S ribosomal protein L36 -
CFU2785_RS18250 3636766..3637026 - 261 WP_003835926.1 type B 50S ribosomal protein L31 -
CFU2785_RS18255 3637215..3638764 + 1550 Protein_3476 EAL domain-containing protein -
CFU2785_RS18260 3638816..3639169 - 354 WP_003831033.1 DUF1428 family protein -
CFU2785_RS18265 3639234..3639863 - 630 WP_016149709.1 membrane protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T292857 WP_002892050.1 NZ_LS992183:3634882-3635100 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14427.23 Da        Isoelectric Point: 5.5653

>AT292857 WP_003021733.1 NZ_LS992183:3634480-3634854 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB R8WZW8

References