Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 154271..154896 | Replicon | plasmid 2 |
| Accession | NZ_LS992167 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO6 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | ECTO6_RS24775 | Protein ID | WP_000911324.1 |
| Coordinates | 154498..154896 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | L4J1D2 |
| Locus tag | ECTO6_RS24770 | Protein ID | WP_000450532.1 |
| Coordinates | 154271..154498 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO6_RS24770 | 154271..154498 | + | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| ECTO6_RS24775 | 154498..154896 | + | 399 | WP_000911324.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| ECTO6_RS24780 | 154905..157058 | - | 2154 | WP_000009350.1 | type IV conjugative transfer system coupling protein TraD | - |
| ECTO6_RS24790 | 157311..158042 | - | 732 | WP_000850422.1 | complement resistance protein TraT | - |
| ECTO6_RS24795 | 158067..158588 | - | 522 | WP_000632670.1 | conjugal transfer entry exclusion protein TraS | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD / tet(A) / mph(B) / sul1 / qacE / ant(3'')-Ia / dfrA1 / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B / catA1 | iroN / iroE / iroD / iroC / iroB | 1..174857 | 174857 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14800.09 Da Isoelectric Point: 7.8604
>T292727 WP_000911324.1 NZ_LS992167:154498-154896 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|