Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 17994..18420 | Replicon | plasmid 2 |
| Accession | NZ_LS992167 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO6 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | ECTO6_RS23875 | Protein ID | WP_001312861.1 |
| Coordinates | 17994..18152 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 18196..18420 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO6_RS23835 | 13364..14053 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| ECTO6_RS23840 | 14240..14623 | - | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| ECTO6_RS23845 | 14944..15546 | + | 603 | WP_000243709.1 | transglycosylase SLT domain-containing protein | - |
| ECTO6_RS23850 | 15843..16664 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| ECTO6_RS23855 | 16785..17072 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| ECTO6_RS25120 | 17097..17303 | - | 207 | WP_000547939.1 | hypothetical protein | - |
| ECTO6_RS23875 | 17994..18152 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 18196..18420 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 18196..18420 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 18196..18420 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 18196..18420 | - | 225 | NuclAT_0 | - | Antitoxin |
| ECTO6_RS25050 | 18232..18420 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| ECTO6_RS23880 | 18432..19151 | - | 720 | WP_001276228.1 | plasmid SOS inhibition protein A | - |
| ECTO6_RS23885 | 19148..19582 | - | 435 | WP_000845895.1 | conjugation system SOS inhibitor PsiB | - |
| ECTO6_RS23890 | 19637..21595 | - | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
| ECTO6_RS23895 | 21654..21887 | - | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| ECTO6_RS23900 | 21943..22470 | - | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD / tet(A) / mph(B) / sul1 / qacE / ant(3'')-Ia / dfrA1 / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B / catA1 | iroN / iroE / iroD / iroC / iroB | 1..174857 | 174857 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T292721 WP_001312861.1 NZ_LS992167:c18152-17994 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 225 bp
>AT292721 NZ_LS992167:c18420-18196 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|