Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1166885..1167516 Replicon chromosome
Accession NZ_LR994655
Organism Serratia sp. Tan611 isolate Serratia sp. Tan611

Toxin (Protein)


Gene name Hha Uniprot ID L0MF14
Locus tag TAN611_RS05430 Protein ID WP_015671220.1
Coordinates 1166885..1167088 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID -
Locus tag TAN611_RS05435 Protein ID WP_105230044.1
Coordinates 1167148..1167516 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
TAN611_RS05410 1162081..1162503 + 423 WP_187043541.1 hypothetical protein -
TAN611_RS05415 1162538..1163881 - 1344 WP_203067371.1 NCS2 family permease -
TAN611_RS05420 1163951..1165738 - 1788 WP_203067372.1 amidohydrolase family protein -
TAN611_RS05425 1165877..1166809 + 933 WP_187043539.1 LysR family transcriptional regulator -
TAN611_RS05430 1166885..1167088 - 204 WP_015671220.1 hemolysin expression modulator Hha Toxin
TAN611_RS05435 1167148..1167516 - 369 WP_105230044.1 Hha toxicity modulator TomB Antitoxin
TAN611_RS05440 1167892..1168245 - 354 WP_203067373.1 hypothetical protein -
TAN611_RS05445 1168503..1168649 + 147 WP_158684784.1 hypothetical protein -
TAN611_RS05450 1168646..1169350 + 705 WP_197951401.1 ABC transporter ATP-binding protein -
TAN611_RS05455 1169347..1170213 + 867 WP_105230047.1 metal ABC transporter permease -
TAN611_RS05460 1170229..1171104 + 876 WP_105230048.1 metal ABC transporter substrate-binding protein -
TAN611_RS05465 1171203..1171343 - 141 WP_004940304.1 type B 50S ribosomal protein L36 -
TAN611_RS05470 1171353..1171607 - 255 WP_015671227.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-117)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8049.33 Da        Isoelectric Point: 7.9816

>T292100 WP_015671220.1 NZ_LR994655:c1167088-1166885 [Serratia sp. Tan611]
MTKTDYLMRLRKCTTIDTLERVIEKNKYALSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14350.17 Da        Isoelectric Point: 4.6346

>AT292100 WP_105230044.1 NZ_LR994655:c1167516-1167148 [Serratia sp. Tan611]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNELIEHIASFVMSYKIKYMDESDFSELVEEYL
DDTYTLFSNYGINDSDLRRWQKTKLRLFRMFSGEVCCTKMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A857EAE6

Antitoxin

Source ID Structure

References