Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 5027133..5027735 | Replicon | chromosome |
| Accession | NZ_LR890714 | ||
| Organism | Escherichia coli isolate MSB1_6C-sc-2280315 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | JMW19_RS23945 | Protein ID | WP_000897305.1 |
| Coordinates | 5027424..5027735 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | JMW19_RS23940 | Protein ID | WP_000356395.1 |
| Coordinates | 5027133..5027423 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW19_RS23905 | 5022757..5023659 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| JMW19_RS23910 | 5023656..5024291 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| JMW19_RS23915 | 5024288..5025217 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| JMW19_RS23920 | 5025399..5025641 | - | 243 | WP_001309881.1 | ribbon-helix-helix domain-containing protein | - |
| JMW19_RS23925 | 5025860..5026078 | - | 219 | WP_001295676.1 | ribbon-helix-helix domain-containing protein | - |
| JMW19_RS23930 | 5026497..5026775 | - | 279 | WP_001315112.1 | hypothetical protein | - |
| JMW19_RS23935 | 5026827..5027048 | - | 222 | WP_001550354.1 | hypothetical protein | - |
| JMW19_RS23940 | 5027133..5027423 | - | 291 | WP_000356395.1 | helix-turn-helix domain-containing protein | Antitoxin |
| JMW19_RS23945 | 5027424..5027735 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| JMW19_RS23950 | 5027964..5028872 | + | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
| JMW19_RS23955 | 5029040..5030854 | - | 1815 | WP_001550352.1 | hypothetical protein | - |
| JMW19_RS23960 | 5031270..5032211 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| JMW19_RS23965 | 5032256..5032693 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T291945 WP_000897305.1 NZ_LR890714:c5027735-5027424 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|