Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1075493..1076147 | Replicon | chromosome |
| Accession | NZ_LR890714 | ||
| Organism | Escherichia coli isolate MSB1_6C-sc-2280315 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | JMW19_RS05185 | Protein ID | WP_000244781.1 |
| Coordinates | 1075740..1076147 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A0V9GG32 |
| Locus tag | JMW19_RS05180 | Protein ID | WP_001564007.1 |
| Coordinates | 1075493..1075759 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW19_RS05160 | 1071581..1073014 | - | 1434 | WP_001564009.1 | 6-phospho-beta-glucosidase BglA | - |
| JMW19_RS05165 | 1073059..1073370 | + | 312 | WP_001182966.1 | N(4)-acetylcytidine aminohydrolase | - |
| JMW19_RS05170 | 1073534..1074193 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| JMW19_RS05175 | 1074270..1075250 | - | 981 | WP_001564008.1 | tRNA-modifying protein YgfZ | - |
| JMW19_RS05180 | 1075493..1075759 | + | 267 | WP_001564007.1 | FAD assembly factor SdhE | Antitoxin |
| JMW19_RS05185 | 1075740..1076147 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| JMW19_RS05190 | 1076187..1076708 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| JMW19_RS05195 | 1076820..1077716 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| JMW19_RS05200 | 1077741..1078451 | + | 711 | WP_001564005.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| JMW19_RS05205 | 1078457..1080190 | + | 1734 | WP_001564004.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T291925 WP_000244781.1 NZ_LR890714:1075740-1076147 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1PAM6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9GG32 |