Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 117298..117899 Replicon plasmid 2
Accession NZ_LR890607
Organism Escherichia coli isolate MINF_8D-sc-2280460

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag JMW69_RS23955 Protein ID WP_001216034.1
Coordinates 117519..117899 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag JMW69_RS23950 Protein ID WP_001190712.1
Coordinates 117298..117519 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW69_RS23940 114279..115562 - 1284 WP_001617890.1 restriction endonuclease subunit S -
JMW69_RS23945 115559..117115 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
JMW69_RS23950 117298..117519 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMW69_RS23955 117519..117899 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMW69_RS23960 117904..118083 + 180 WP_001513661.1 hypothetical protein -
JMW69_RS23965 118111..118470 + 360 WP_001513660.1 hypothetical protein -
JMW69_RS23970 118394..118768 + 375 Protein_138 DDE-type integrase/transposase/recombinase -
JMW69_RS23975 118797..119494 + 698 Protein_139 IS1 family transposase -
JMW69_RS23980 119730..120746 - 1017 WP_012372828.1 IS5-like element IS5 family transposase -
JMW69_RS23985 120954..122357 + 1404 WP_001373486.1 S-methylmethionine permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA17 / aadA5 / qacE / sul1 / mph(A) / erm(B) senB 1..126618 126618


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T291574 WP_001216034.1 NZ_LR890607:117519-117899 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT291574 WP_001190712.1 NZ_LR890607:117298-117519 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References