Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 87275..87701 | Replicon | plasmid 2 |
| Accession | NZ_LR890607 | ||
| Organism | Escherichia coli isolate MINF_8D-sc-2280460 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | JMW69_RS23790 | Protein ID | WP_001312861.1 |
| Coordinates | 87275..87433 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 87477..87701 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW69_RS23755 | 82480..82614 | - | 135 | Protein_95 | TraY domain-containing protein | - |
| JMW69_RS23760 | 82702..83379 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| JMW69_RS23765 | 83513..83896 | - | 384 | WP_001151566.1 | relaxosome protein TraM | - |
| JMW69_RS23770 | 84227..84829 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| JMW69_RS23775 | 85126..85947 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| JMW69_RS23780 | 86066..86353 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| JMW69_RS23785 | 86378..86584 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| JMW69_RS23790 | 87275..87433 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 87477..87701 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 87477..87701 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 87477..87701 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 87477..87701 | - | 225 | NuclAT_0 | - | Antitoxin |
| JMW69_RS23795 | 87513..87701 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| JMW69_RS23800 | 87713..88432 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| JMW69_RS23805 | 88429..88863 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| JMW69_RS23810 | 88918..90876 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
| JMW69_RS23815 | 90942..91175 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| JMW69_RS23820 | 91238..91777 | - | 540 | WP_000290841.1 | single-stranded DNA-binding protein | - |
| JMW69_RS23825 | 92420..92674 | - | 255 | WP_047605447.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / erm(B) | senB | 1..126618 | 126618 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T291569 WP_001312861.1 NZ_LR890607:c87433-87275 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 225 bp
>AT291569 NZ_LR890607:c87701-87477 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|