Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 63065..63304 | Replicon | plasmid 2 |
| Accession | NZ_LR890607 | ||
| Organism | Escherichia coli isolate MINF_8D-sc-2280460 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | JMW69_RS23665 | Protein ID | WP_023144756.1 |
| Coordinates | 63065..63199 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 63244..63304 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW69_RS23625 | 58412..58827 | - | 416 | Protein_69 | IS1 family transposase | - |
| JMW69_RS23630 | 59076..59477 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| JMW69_RS23635 | 59410..59667 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| JMW69_RS23640 | 59760..60413 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| JMW69_RS23645 | 61353..62210 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| JMW69_RS23650 | 62203..62277 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| JMW69_RS23655 | 62274..62408 | - | 135 | Protein_75 | protein CopA/IncA | - |
| JMW69_RS23660 | 62514..62768 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| JMW69_RS23665 | 63065..63199 | - | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 63244..63304 | + | 61 | NuclAT_1 | - | Antitoxin |
| - | 63244..63304 | + | 61 | NuclAT_1 | - | Antitoxin |
| - | 63244..63304 | + | 61 | NuclAT_1 | - | Antitoxin |
| - | 63244..63304 | + | 61 | NuclAT_1 | - | Antitoxin |
| JMW69_RS23670 | 63271..63557 | - | 287 | Protein_78 | DUF2726 domain-containing protein | - |
| JMW69_RS23675 | 64070..64282 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| JMW69_RS23680 | 64413..64973 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| JMW69_RS23685 | 65028..65774 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / erm(B) | senB | 1..126618 | 126618 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T291565 WP_023144756.1 NZ_LR890607:c63199-63065 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT291565 NZ_LR890607:63244-63304 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|