Detailed information of TA system TA291565

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 63065..63304
• Replicon: plasmid 2
• Accession: NZ_LR890607
• Organism: Escherichia coli isolate MINF_8D-sc-2280460

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: A0A762TWR7
• Locus tag: JMW69_RS23665
• Protein ID: WP_023144756.1
• Coordinates: 63065..63199 (-)
• Length: 45 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	63244..63304 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JMW69_RS23625	58412..58827	-	416	Protein_69	IS1 family transposase	-
JMW69_RS23630	59076..59477	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
JMW69_RS23635	59410..59667	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
JMW69_RS23640	59760..60413	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
JMW69_RS23645	61353..62210	-	858	WP_001617855.1	incFII family plasmid replication initiator RepA	-
JMW69_RS23650	62203..62277	-	75	WP_031943482.1	RepA leader peptide Tap	-
JMW69_RS23655	62274..62408	-	135	Protein_75	protein CopA/IncA	-
JMW69_RS23660	62514..62768	-	255	WP_000083850.1	replication regulatory protein RepA	-
JMW69_RS23665	63065..63199	-	135	WP_023144756.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	63244..63304	+	61	NuclAT_1	-	Antitoxin
-	63244..63304	+	61	NuclAT_1	-	Antitoxin
-	63244..63304	+	61	NuclAT_1	-	Antitoxin
-	63244..63304	+	61	NuclAT_1	-	Antitoxin
JMW69_RS23670	63271..63557	-	287	Protein_78	DUF2726 domain-containing protein	-
JMW69_RS23675	64070..64282	-	213	WP_013023861.1	hypothetical protein	-
JMW69_RS23680	64413..64973	-	561	WP_000139341.1	fertility inhibition protein FinO	-
JMW69_RS23685	65028..65774	-	747	WP_000205718.1	conjugal transfer pilus acetylase TraX	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	dfrA17 / aadA5 / qacE / sul1 / mph(A) / erm(B)	senB	1..126618	126618

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-44)

Sequences

Toxin

Protein

• Length: 45 a.a.
• Molecular weight: 4896.90 Da
• Isoelectric Point: 7.7209

>T291565 WP_023144756.1 NZ_LR890607:c63199-63065 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Nucleotide

• Length: 135 bp

Antitoxin

Nucleotide

• Length: 61 bp

>AT291565 NZ_LR890607:63244-63304 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A762TWR7

Antitoxin