Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4269377..4269927 Replicon chromosome
Accession NZ_LR890536
Organism Escherichia coli isolate MSB1_8B-sc-2280300

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag JMX06_RS20560 Protein ID WP_001160966.1
Coordinates 4269377..4269691 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag JMX06_RS20565 Protein ID WP_000125568.1
Coordinates 4269694..4269927 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX06_RS20535 4265052..4266338 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
JMX06_RS20540 4266338..4267327 + 990 WP_000241224.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
JMX06_RS20545 4267324..4268145 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
JMX06_RS20550 4268148..4268525 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
JMX06_RS20555 4268532..4269380 + 849 WP_000257195.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
JMX06_RS20560 4269377..4269691 - 315 WP_001160966.1 CcdB family protein Toxin
JMX06_RS20565 4269694..4269927 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
JMX06_RS20570 4270013..4270492 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
JMX06_RS20575 4270684..4272546 - 1863 WP_022645165.1 glutathione-regulated potassium-efflux system protein KefC -
JMX06_RS20580 4272539..4273069 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
JMX06_RS20585 4273177..4274508 - 1332 WP_001183201.1 MFS transporter -
JMX06_RS20590 4274566..4274853 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T291318 WP_001160966.1 NZ_LR890536:c4269691-4269377 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT291318 WP_000125568.1 NZ_LR890536:c4269927-4269694 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References