Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapC-vagC/VapC-VagC |
| Location | 156627..157264 | Replicon | chromosome |
| Accession | NZ_LR890523 | ||
| Organism | Burkholderia cepacia isolate MINF_4A-sc-2280433 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A364GQ02 |
| Locus tag | ISX57_RS00725 | Protein ID | WP_034201143.1 |
| Coordinates | 156863..157264 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A364GPY9 |
| Locus tag | ISX57_RS00720 | Protein ID | WP_034201144.1 |
| Coordinates | 156627..156863 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ISX57_RS00700 | 152003..153019 | + | 1017 | WP_077190295.1 | helix-turn-helix domain-containing protein | - |
| ISX57_RS00705 | 153114..154211 | - | 1098 | WP_194131029.1 | ADP-heptose--LPS heptosyltransferase | - |
| ISX57_RS00710 | 154208..155911 | - | 1704 | WP_034201145.1 | thiamine pyrophosphate-binding protein | - |
| ISX57_RS00715 | 156226..156509 | + | 284 | Protein_138 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| ISX57_RS00720 | 156627..156863 | + | 237 | WP_034201144.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| ISX57_RS00725 | 156863..157264 | + | 402 | WP_034201143.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| ISX57_RS00730 | 157332..158720 | - | 1389 | WP_194131030.1 | L-serine ammonia-lyase | - |
| ISX57_RS00735 | 158751..159893 | - | 1143 | WP_006496280.1 | alginate lyase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15099.33 Da Isoelectric Point: 6.2271
>T291272 WP_034201143.1 NZ_LR890523:156863-157264 [Burkholderia cepacia]
MPRFMLDTNMCIYLMKNQPEQVARRFARCYTGDVVMSAITYAELEYGLTACVNPARERRHLAALIEDIPVAPFDAAAAQA
YGPVREATRERKKDHLDKLIAAHAVSLDVVLVTNNERDFVSYPGLRLENWLND
MPRFMLDTNMCIYLMKNQPEQVARRFARCYTGDVVMSAITYAELEYGLTACVNPARERRHLAALIEDIPVAPFDAAAAQA
YGPVREATRERKKDHLDKLIAAHAVSLDVVLVTNNERDFVSYPGLRLENWLND
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A364GQ02 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A364GPY9 |