Detailed information of TA system TA291268

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 28234..28503
• Replicon: plasmid 5
• Accession: NZ_LR890519
• Organism: Klebsiella pneumoniae isolate INF281-sc-2280206

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: JMX78_RS29410
• Protein ID: WP_001312861.1
• Coordinates: 28345..28503 (+)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	28234..28299 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JMX78_RS29385	24003..24530	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
JMX78_RS29390	24588..24821	+	234	WP_000006003.1	DUF905 family protein	-
JMX78_RS29395	24882..26846	+	1965	WP_117389470.1	ParB/RepB/Spo0J family partition protein	-
JMX78_RS29400	26915..27349	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
JMX78_RS29405	27346..28065	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	28077..28301	+	225	NuclAT_0	-	-
-	28077..28301	+	225	NuclAT_0	-	-
-	28077..28301	+	225	NuclAT_0	-	-
-	28077..28301	+	225	NuclAT_0	-	-
-	28234..28299	-	66	-	-	Antitoxin
JMX78_RS29410	28345..28503	+	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
JMX78_RS29415	28804..29008	-	205	Protein_38	pilus protein	-
JMX78_RS29420	29400..29696	+	297	WP_001272251.1	hypothetical protein	-
JMX78_RS29425	29807..30628	+	822	WP_001234445.1	DUF945 domain-containing protein	-
JMX78_RS29430	30925..31515	-	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
JMX78_RS29435	31848..32231	+	384	WP_001151529.1	relaxosome protein TraM	-
JMX78_RS29440	32423..33070	+	648	WP_000332523.1	transcriptional regulator TraJ family protein	-
JMX78_RS29445	33178..33417	+	240	WP_042018283.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	erm(B)	-	1..70656	70656

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T291268 WP_001312861.1 NZ_LR890519:28345-28503 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT291268 NZ_LR890519:c28299-28234 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin