Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 66629..67055 | Replicon | plasmid 2 |
| Accession | NZ_LR890509 | ||
| Organism | Escherichia coli isolate MSB1_9I-sc-2280417 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | JMW57_RS23300 | Protein ID | WP_001312861.1 |
| Coordinates | 66629..66787 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 66831..67055 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW57_RS23270 | 62003..62692 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| JMW57_RS23275 | 62879..63262 | - | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| JMW57_RS23280 | 63583..64185 | + | 603 | WP_112030399.1 | transglycosylase SLT domain-containing protein | - |
| JMW57_RS23285 | 64481..65302 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| JMW57_RS23290 | 65420..65707 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| JMW57_RS23295 | 66179..66334 | - | 156 | WP_201524621.1 | hypothetical protein | - |
| JMW57_RS23300 | 66629..66787 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 66831..67055 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 66831..67055 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 66831..67055 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 66831..67055 | - | 225 | NuclAT_0 | - | Antitoxin |
| JMW57_RS23305 | 66867..67055 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| JMW57_RS23310 | 67067..67786 | - | 720 | WP_112030397.1 | plasmid SOS inhibition protein A | - |
| JMW57_RS23315 | 67783..68217 | - | 435 | WP_032217500.1 | conjugation system SOS inhibitor PsiB | - |
| JMW57_RS23320 | 68272..70230 | - | 1959 | WP_112030396.1 | ParB/RepB/Spo0J family partition protein | - |
| JMW57_RS23325 | 70295..70528 | - | 234 | WP_000006030.1 | DUF905 family protein | - |
| JMW57_RS23330 | 70590..71129 | - | 540 | WP_009426937.1 | single-stranded DNA-binding protein | - |
| JMW57_RS23335 | 71602..71757 | - | 156 | WP_165369128.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..91228 | 91228 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T291243 WP_001312861.1 NZ_LR890509:c66787-66629 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 225 bp
>AT291243 NZ_LR890509:c67055-66831 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|