Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 325676..326262 Replicon chromosome
Accession NZ_LR890474
Organism Klebsiella pneumoniae isolate INF358-sc-2280191

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag JMX23_RS01520 Protein ID WP_002920800.1
Coordinates 325894..326262 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag JMX23_RS01515 Protein ID WP_004174006.1
Coordinates 325676..325897 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX23_RS01495 321833..322759 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMX23_RS01500 322756..324033 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
JMX23_RS01505 324030..324797 + 768 WP_065809414.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMX23_RS01510 324799..325512 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMX23_RS01515 325676..325897 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMX23_RS01520 325894..326262 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMX23_RS01525 326535..327851 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMX23_RS01530 327958..328845 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMX23_RS01535 328842..329687 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMX23_RS01540 329689..330759 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 315197..331496 16299


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T291138 WP_002920800.1 NZ_LR890474:325894-326262 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT291138 WP_004174006.1 NZ_LR890474:325676-325897 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References