Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 56027..56763 | Replicon | plasmid 2 |
Accession | NZ_LR890472 | ||
Organism | Klebsiella pneumoniae isolate INF168-sc-2280023 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A8T5ZF70 |
Locus tag | JMX14_RS26180 | Protein ID | WP_004187044.1 |
Coordinates | 56281..56763 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | JMX14_RS26175 | Protein ID | WP_003026799.1 |
Coordinates | 56027..56293 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX14_RS26160 | 51499..52893 | + | 1395 | WP_032439652.1 | cytosine permease | - |
JMX14_RS26165 | 52905..54113 | + | 1209 | WP_032448288.1 | imidazolonepropionase | - |
JMX14_RS26170 | 54106..54915 | + | 810 | WP_023329017.1 | N-formylglutamate deformylase | - |
JMX14_RS26175 | 56027..56293 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
JMX14_RS26180 | 56281..56763 | + | 483 | WP_004187044.1 | GNAT family N-acetyltransferase | Toxin |
JMX14_RS26185 | 56970..58316 | + | 1347 | WP_077254728.1 | ISNCY family transposase | - |
JMX14_RS26190 | 58365..58763 | + | 399 | WP_032422684.1 | helix-turn-helix domain-containing protein | - |
JMX14_RS26195 | 58911..59018 | - | 108 | Protein_58 | IS3 family transposase | - |
JMX14_RS26200 | 59016..59186 | - | 171 | Protein_59 | transposase | - |
JMX14_RS26205 | 59296..60232 | + | 937 | Protein_60 | ISNCY family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..177028 | 177028 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17280.93 Da Isoelectric Point: 8.7197
>T291137 WP_004187044.1 NZ_LR890472:56281-56763 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|