Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4824523..4825039 | Replicon | chromosome |
| Accession | NZ_LR890471 | ||
| Organism | Klebsiella pneumoniae isolate INF168-sc-2280023 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A483NZA3 |
| Locus tag | JMX14_RS23275 | Protein ID | WP_004894697.1 |
| Coordinates | 4824523..4824807 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | JMX14_RS23280 | Protein ID | WP_002886901.1 |
| Coordinates | 4824797..4825039 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX14_RS23250 | 4819918..4820226 | - | 309 | WP_004894688.1 | PTS sugar transporter subunit IIB | - |
| JMX14_RS23255 | 4820311..4820484 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| JMX14_RS23260 | 4820487..4821230 | + | 744 | WP_004894691.1 | MurR/RpiR family transcriptional regulator | - |
| JMX14_RS23265 | 4821588..4823726 | + | 2139 | WP_023325427.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| JMX14_RS23270 | 4824055..4824519 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| JMX14_RS23275 | 4824523..4824807 | - | 285 | WP_004894697.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMX14_RS23280 | 4824797..4825039 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| JMX14_RS23285 | 4825117..4827027 | - | 1911 | WP_023325426.1 | BglG family transcription antiterminator | - |
| JMX14_RS23290 | 4827050..4828204 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
| JMX14_RS23295 | 4828271..4829011 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11174.05 Da Isoelectric Point: 10.3787
>T291134 WP_004894697.1 NZ_LR890471:c4824807-4824523 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIMQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIMQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A483NZA3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |