Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4099134..4099753 Replicon chromosome
Accession NZ_LR890471
Organism Klebsiella pneumoniae isolate INF168-sc-2280023

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMX14_RS19815 Protein ID WP_002892050.1
Coordinates 4099535..4099753 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMX14_RS19810 Protein ID WP_002892066.1
Coordinates 4099134..4099508 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX14_RS19800 4094286..4095479 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMX14_RS19805 4095502..4098648 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
JMX14_RS19810 4099134..4099508 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMX14_RS19815 4099535..4099753 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMX14_RS19820 4099912..4100478 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMX14_RS19825 4100450..4100590 - 141 WP_032409038.1 hypothetical protein -
JMX14_RS19830 4100611..4101081 + 471 WP_002892026.1 YlaC family protein -
JMX14_RS19835 4101056..4102507 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
JMX14_RS19840 4102608..4103306 + 699 WP_004893822.1 GNAT family N-acetyltransferase -
JMX14_RS19845 4103303..4103443 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
JMX14_RS19850 4103443..4103706 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T291131 WP_002892050.1 NZ_LR890471:4099535-4099753 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT291131 WP_002892066.1 NZ_LR890471:4099134-4099508 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References