Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1783694..1784284 | Replicon | chromosome |
| Accession | NZ_LR890424 | ||
| Organism | Klebsiella pneumoniae isolate INF331-sc-2280141 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A2L1BXX2 |
| Locus tag | JMX49_RS08565 | Protein ID | WP_022615588.1 |
| Coordinates | 1783952..1784284 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A3S7DDD0 |
| Locus tag | JMX49_RS08560 | Protein ID | WP_000288812.1 |
| Coordinates | 1783694..1783951 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX49_RS08540 | 1780030..1781778 | + | 1749 | WP_023302666.1 | hypothetical protein | - |
| JMX49_RS08545 | 1781857..1782413 | + | 557 | Protein_1673 | hypothetical protein | - |
| JMX49_RS08550 | 1782696..1783156 | + | 461 | Protein_1674 | hypothetical protein | - |
| JMX49_RS08555 | 1783153..1783359 | + | 207 | WP_022615589.1 | helix-turn-helix domain-containing protein | - |
| JMX49_RS08560 | 1783694..1783951 | + | 258 | WP_000288812.1 | antitoxin | Antitoxin |
| JMX49_RS08565 | 1783952..1784284 | + | 333 | WP_022615588.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| JMX49_RS08575 | 1784606..1786042 | + | 1437 | WP_004151469.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| JMX49_RS08585 | 1786408..1787862 | - | 1455 | WP_004148975.1 | AMP nucleosidase | - |
| JMX49_RS08590 | 1787992..1788237 | - | 246 | WP_004141189.1 | signal transduction protein PmrD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11913.80 Da Isoelectric Point: 10.1839
>T290971 WP_022615588.1 NZ_LR890424:1783952-1784284 [Klebsiella pneumoniae]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDVVVNEVLARLDAMLS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDVVVNEVLARLDAMLS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2L1BXX2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S7DDD0 |