Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 37491..38215 | Replicon | plasmid 4 |
| Accession | NZ_LR890363 | ||
| Organism | Klebsiella pneumoniae isolate INF049-sc-2279950 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2J4YLV3 |
| Locus tag | JMW75_RS27390 | Protein ID | WP_023292165.1 |
| Coordinates | 37491..37802 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | JMW75_RS27395 | Protein ID | WP_020801939.1 |
| Coordinates | 37799..38215 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW75_RS27360 | 34179..34610 | + | 432 | WP_020804574.1 | conjugation system SOS inhibitor PsiB | - |
| JMW75_RS27365 | 34607..35329 | + | 723 | WP_020804573.1 | plasmid SOS inhibition protein A | - |
| JMW75_RS27370 | 35687..35959 | + | 273 | WP_042922555.1 | hypothetical protein | - |
| JMW75_RS27375 | 35956..36306 | + | 351 | WP_004152758.1 | hypothetical protein | - |
| JMW75_RS27380 | 36943..37149 | + | 207 | WP_042922554.1 | hypothetical protein | - |
| JMW75_RS27385 | 37160..37384 | + | 225 | WP_042922612.1 | hypothetical protein | - |
| JMW75_RS27390 | 37491..37802 | + | 312 | WP_023292165.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| JMW75_RS27395 | 37799..38215 | + | 417 | WP_020801939.1 | helix-turn-helix domain-containing protein | Antitoxin |
| JMW75_RS27400 | 38937..39317 | + | 381 | WP_020802391.1 | hypothetical protein | - |
| JMW75_RS27405 | 39384..39731 | + | 348 | WP_020804846.1 | hypothetical protein | - |
| JMW75_RS27410 | 39826..39972 | + | 147 | WP_004152750.1 | hypothetical protein | - |
| JMW75_RS27415 | 40021..40854 | + | 834 | WP_020804845.1 | type I restriction-modification system subunit M | - |
| JMW75_RS27420 | 41680..42501 | + | 822 | WP_020804822.1 | DUF945 domain-containing protein | - |
| JMW75_RS27425 | 42561..42869 | + | 309 | WP_071599372.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..76738 | 76738 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12497.32 Da Isoelectric Point: 9.9242
>T290781 WP_023292165.1 NZ_LR890363:37491-37802 [Klebsiella pneumoniae]
VHVISRAPFDEAARHYPNDAAAIDDTYRVLKRVVAKKPDELKRYFTSLDRMKYREKWWVIDIGGNNLRMMFFADFERGKI
FVKHITTHAEYDRLTKYYREHKE
VHVISRAPFDEAARHYPNDAAAIDDTYRVLKRVVAKKPDELKRYFTSLDRMKYREKWWVIDIGGNNLRMMFFADFERGKI
FVKHITTHAEYDRLTKYYREHKE
Download Length: 312 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15380.49 Da Isoelectric Point: 4.5542
>AT290781 WP_020801939.1 NZ_LR890363:37799-38215 [Klebsiella pneumoniae]
MIFSDAIKAANDLASIVPLLGGSSSRKDYEEALKLVEYLLEHDPDSPLVDMLTARIDAWEDNAVEFEEFNTRIEAGKNGV
SLLRVLMQQHGLSQSDFENEIGKKSLVSRILSGERSLTLDHMRALANRFQIPVSMFVG
MIFSDAIKAANDLASIVPLLGGSSSRKDYEEALKLVEYLLEHDPDSPLVDMLTARIDAWEDNAVEFEEFNTRIEAGKNGV
SLLRVLMQQHGLSQSDFENEIGKKSLVSRILSGERSLTLDHMRALANRFQIPVSMFVG
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|