Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 69039..69775 | Replicon | plasmid 2 |
| Accession | NZ_LR890361 | ||
| Organism | Klebsiella pneumoniae isolate INF049-sc-2279950 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | JMW75_RS25885 | Protein ID | WP_003026803.1 |
| Coordinates | 69293..69775 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | JMW75_RS25880 | Protein ID | WP_003026799.1 |
| Coordinates | 69039..69305 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW75_RS25860 | 65531..65839 | - | 309 | WP_017896554.1 | hypothetical protein | - |
| JMW75_RS25870 | 67443..68423 | - | 981 | WP_020806188.1 | IS5-like element ISKpn26 family transposase | - |
| JMW75_RS25875 | 68492..68794 | + | 303 | Protein_72 | cell envelope integrity protein TolA | - |
| JMW75_RS25880 | 69039..69305 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| JMW75_RS25885 | 69293..69775 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| JMW75_RS25890 | 69976..71379 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| JMW75_RS25895 | 71408..72040 | - | 633 | WP_001567369.1 | hypothetical protein | - |
| JMW75_RS25900 | 72564..73568 | - | 1005 | WP_000427620.1 | IS110-like element IS4321 family transposase | - |
| JMW75_RS25905 | 73647..74204 | - | 558 | WP_003100847.1 | recombinase family protein | - |
| JMW75_RS25910 | 74198..74569 | - | 372 | WP_003100853.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | mrkA / mrkB / mrkC / mrkD / mrkF / mrkJ | 1..233670 | 233670 | |
| - | inside | IScluster/Tn | - | - | 65946..80889 | 14943 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T290779 WP_003026803.1 NZ_LR890361:69293-69775 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |