Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 25065..25708 | Replicon | plasmid 2 |
| Accession | NZ_LR890361 | ||
| Organism | Klebsiella pneumoniae isolate INF049-sc-2279950 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A3Q8D6L7 |
| Locus tag | JMW75_RS25660 | Protein ID | WP_020804312.1 |
| Coordinates | 25292..25708 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | JMW75_RS25655 | Protein ID | WP_001261276.1 |
| Coordinates | 25065..25295 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW75_RS25615 | 20605..20718 | + | 114 | WP_014343462.1 | hypothetical protein | - |
| JMW75_RS25620 | 20847..21104 | + | 258 | WP_009310077.1 | hypothetical protein | - |
| JMW75_RS25625 | 21162..21941 | - | 780 | WP_023287113.1 | site-specific integrase | - |
| JMW75_RS25630 | 22139..23155 | - | 1017 | WP_009309921.1 | hypothetical protein | - |
| JMW75_RS25635 | 23189..23524 | - | 336 | WP_009309920.1 | hypothetical protein | - |
| JMW75_RS25640 | 23574..23714 | - | 141 | WP_162898808.1 | hypothetical protein | - |
| JMW75_RS25645 | 23943..24248 | - | 306 | WP_004197633.1 | type II toxin-antitoxin system toxin CcdB | - |
| JMW75_RS25650 | 24250..24468 | - | 219 | WP_006788213.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| JMW75_RS25655 | 25065..25295 | + | 231 | WP_001261276.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| JMW75_RS25660 | 25292..25708 | + | 417 | WP_020804312.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMW75_RS25665 | 25749..26627 | - | 879 | WP_032427228.1 | restriction endonuclease | - |
| JMW75_RS25670 | 27289..28566 | + | 1278 | WP_009309915.1 | HlyD family secretion protein | - |
| JMW75_RS25675 | 28556..30664 | + | 2109 | WP_032427226.1 | peptidase domain-containing ABC transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 19522..20502 | 980 | |
| - | inside | Conjugative plasmid | - | mrkA / mrkB / mrkC / mrkD / mrkF / mrkJ | 1..233670 | 233670 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15154.59 Da Isoelectric Point: 7.8637
>T290777 WP_020804312.1 NZ_LR890361:25292-25708 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPESVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPESVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Q8D6L7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |