Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 86439..86964 Replicon plasmid 2
Accession NZ_LR890357
Organism Klebsiella pneumoniae isolate INF231-sc-2280121

Toxin (Protein)


Gene name ccdB Uniprot ID -
Locus tag JMV88_RS26670 Protein ID WP_114502755.1
Coordinates 86659..86964 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A9E1GDP8
Locus tag JMV88_RS26665 Protein ID WP_004197642.1
Coordinates 86439..86657 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV88_RS26630 81881..82453 - 573 WP_032720635.1 GNAT family N-acetyltransferase -
JMV88_RS26635 82455..83243 - 789 WP_032720700.1 TSUP family transporter -
JMV88_RS26640 83279..84199 - 921 WP_050548604.1 TauD/TfdA family dioxygenase -
JMV88_RS26645 84502..84996 - 495 WP_064167959.1 hypothetical protein -
JMV88_RS26650 85027..85599 - 573 WP_044266753.1 hypothetical protein -
JMV88_RS26655 85596..85844 - 249 WP_044266751.1 hypothetical protein -
JMV88_RS26660 86009..86230 + 222 Protein_89 hypothetical protein -
JMV88_RS26665 86439..86657 + 219 WP_004197642.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
JMV88_RS26670 86659..86964 + 306 WP_114502755.1 type II toxin-antitoxin system toxin CcdB Toxin
JMV88_RS26675 87133..87534 + 402 WP_072199347.1 hypothetical protein -
JMV88_RS26680 87561..87884 + 324 WP_004197641.1 hypothetical protein -
JMV88_RS26685 87881..88897 + 1017 WP_004197639.1 hypothetical protein -
JMV88_RS26690 89095..89874 + 780 WP_095849271.1 site-specific integrase -
JMV88_RS26695 89932..90190 - 259 Protein_96 hypothetical protein -
JMV88_RS26700 90319..90432 - 114 WP_014343462.1 hypothetical protein -
JMV88_RS26705 90967..91419 + 453 Protein_98 RepB family plasmid replication initiator protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..195539 195539


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11631.30 Da        Isoelectric Point: 6.4661

>T290761 WP_114502755.1 NZ_LR890357:86659-86964 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASTRLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8376.34 Da        Isoelectric Point: 4.7405

>AT290761 WP_004197642.1 NZ_LR890357:86439-86657 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References