Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 80118..80792 | Replicon | plasmid 2 |
| Accession | NZ_LR890357 | ||
| Organism | Klebsiella pneumoniae isolate INF231-sc-2280121 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A5Q9LMS5 |
| Locus tag | JMV88_RS26605 | Protein ID | WP_032720638.1 |
| Coordinates | 80118..80441 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | JMV88_RS26610 | Protein ID | WP_032720637.1 |
| Coordinates | 80490..80792 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV88_RS26580 | 75300..77012 | + | 1713 | WP_038992633.1 | ROK family protein | - |
| JMV88_RS26585 | 77442..77924 | - | 483 | WP_032720647.1 | GNAT family N-acetyltransferase | - |
| JMV88_RS26590 | 77912..78178 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | - |
| JMV88_RS26595 | 78459..79061 | + | 603 | Protein_76 | transposase | - |
| JMV88_RS26600 | 79388..79940 | + | 553 | Protein_77 | DUF4113 domain-containing protein | - |
| JMV88_RS26605 | 80118..80441 | + | 324 | WP_032720638.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMV88_RS26610 | 80490..80792 | + | 303 | WP_032720637.1 | helix-turn-helix domain-containing protein | Antitoxin |
| JMV88_RS26615 | 80835..81002 | - | 168 | WP_153591440.1 | hypothetical protein | - |
| JMV88_RS26620 | 81190..81369 | - | 180 | WP_032720701.1 | hypothetical protein | - |
| JMV88_RS26625 | 81393..81776 | - | 384 | WP_032720636.1 | hypothetical protein | - |
| JMV88_RS26630 | 81881..82453 | - | 573 | WP_032720635.1 | GNAT family N-acetyltransferase | - |
| JMV88_RS26635 | 82455..83243 | - | 789 | WP_032720700.1 | TSUP family transporter | - |
| JMV88_RS26640 | 83279..84199 | - | 921 | WP_050548604.1 | TauD/TfdA family dioxygenase | - |
| JMV88_RS26645 | 84502..84996 | - | 495 | WP_064167959.1 | hypothetical protein | - |
| JMV88_RS26650 | 85027..85599 | - | 573 | WP_044266753.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..195539 | 195539 | |
| - | flank | IS/Tn | - | - | 78672..79061 | 389 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12372.29 Da Isoelectric Point: 9.6240
>T290760 WP_032720638.1 NZ_LR890357:80118-80441 [Klebsiella pneumoniae]
MNYLEFVETSAFSGLRKELMDDDEFRELQTYLLEAHDRGDTISHTGGCRKIRWGRPGMGKRGGVRVIYYVRLASGRLYLL
LIYPKNAKDELSEKEKAVMKALTQQLK
MNYLEFVETSAFSGLRKELMDDDEFRELQTYLLEAHDRGDTISHTGGCRKIRWGRPGMGKRGGVRVIYYVRLASGRLYLL
LIYPKNAKDELSEKEKAVMKALTQQLK
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|