Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4881791..4882307 | Replicon | chromosome |
| Accession | NZ_LR890356 | ||
| Organism | Klebsiella pneumoniae isolate INF231-sc-2280121 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A483NZA3 |
| Locus tag | JMV88_RS23585 | Protein ID | WP_004894697.1 |
| Coordinates | 4881791..4882075 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | JMV88_RS23590 | Protein ID | WP_002886901.1 |
| Coordinates | 4882065..4882307 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV88_RS23560 | 4877186..4877494 | - | 309 | WP_004894688.1 | PTS sugar transporter subunit IIB | - |
| JMV88_RS23565 | 4877579..4877752 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| JMV88_RS23570 | 4877755..4878498 | + | 744 | WP_004894691.1 | MurR/RpiR family transcriptional regulator | - |
| JMV88_RS23575 | 4878856..4880994 | + | 2139 | WP_023325427.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| JMV88_RS23580 | 4881323..4881787 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| JMV88_RS23585 | 4881791..4882075 | - | 285 | WP_004894697.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMV88_RS23590 | 4882065..4882307 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| JMV88_RS23595 | 4882385..4884295 | - | 1911 | WP_023325426.1 | BglG family transcription antiterminator | - |
| JMV88_RS23600 | 4884318..4885472 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
| JMV88_RS23605 | 4885539..4886279 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11174.05 Da Isoelectric Point: 10.3787
>T290757 WP_004894697.1 NZ_LR890356:c4882075-4881791 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIMQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIMQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A483NZA3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |