Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 112600..113243 Replicon plasmid 2
Accession NZ_LR890335
Organism Escherichia coli isolate MINF_9A-sc-2280436

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag JMW07_RS25410 Protein ID WP_001034046.1
Coordinates 112600..113016 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag JMW07_RS25415 Protein ID WP_001261278.1
Coordinates 113013..113243 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW07_RS25395 107737..108153 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
JMW07_RS25400 108150..108380 - 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JMW07_RS25405 108761..112555 + 3795 WP_001144732.1 hypothetical protein -
JMW07_RS25410 112600..113016 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
JMW07_RS25415 113013..113243 - 231 WP_001261278.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMW07_RS25420 113508..114008 + 501 WP_000528931.1 hypothetical protein -
JMW07_RS25425 114021..114794 + 774 WP_000905949.1 hypothetical protein -
JMW07_RS25430 114961..116094 + 1134 WP_001542067.1 DUF3800 domain-containing protein -
JMW07_RS25435 116128..116640 - 513 WP_000151784.1 hypothetical protein -
JMW07_RS25440 117207..117425 + 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
JMW07_RS25445 117427..117732 + 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 / sitABCD iucA / iucB / iucC / iucD / iutA 1..139312 139312


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T290711 WP_001034046.1 NZ_LR890335:c113016-112600 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT290711 WP_001261278.1 NZ_LR890335:c113243-113013 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References