Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 15856..16381 | Replicon | plasmid 3 |
| Accession | NZ_LR890319 | ||
| Organism | Klebsiella pneumoniae isolate INF215-sc-2280087 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | A0A9E1GGX2 |
| Locus tag | JMX39_RS26650 | Protein ID | WP_016946795.1 |
| Coordinates | 16076..16381 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A9E1GDP8 |
| Locus tag | JMX39_RS26645 | Protein ID | WP_004197642.1 |
| Coordinates | 15856..16074 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX39_RS26635 | 13538..14566 | - | 1029 | WP_001568023.1 | Abi family protein | - |
| JMX39_RS26640 | 14707..15276 | - | 570 | WP_016162066.1 | hypothetical protein | - |
| JMX39_RS26645 | 15856..16074 | + | 219 | WP_004197642.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| JMX39_RS26650 | 16076..16381 | + | 306 | WP_016946795.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| JMX39_RS26655 | 16539..16922 | + | 384 | WP_063945279.1 | hypothetical protein | - |
| JMX39_RS26660 | 17226..18002 | + | 777 | WP_049245386.1 | site-specific integrase | - |
| JMX39_RS26665 | 18060..18317 | - | 258 | WP_000764642.1 | hypothetical protein | - |
| JMX39_RS26670 | 18446..18550 | - | 105 | WP_032409716.1 | hypothetical protein | - |
| JMX39_RS26675 | 19085..19951 | + | 867 | WP_004118283.1 | replication initiation protein | - |
| JMX39_RS26680 | 20236..20505 | - | 270 | WP_000339857.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..56100 | 56100 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11548.22 Da Isoelectric Point: 5.6831
>T290631 WP_016946795.1 NZ_LR890319:16076-16381 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSCELYPVVHIGDDSYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSCELYPVVHIGDDSYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|