Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 122188..122840 | Replicon | plasmid 2 |
| Accession | NZ_LR890318 | ||
| Organism | Klebsiella pneumoniae isolate INF215-sc-2280087 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A8A2Q2K1 |
| Locus tag | JMX39_RS26080 | Protein ID | WP_017901321.1 |
| Coordinates | 122188..122613 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A853H7M9 |
| Locus tag | JMX39_RS26085 | Protein ID | WP_001261275.1 |
| Coordinates | 122610..122840 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX39_RS26050 | 117897..118013 | + | 117 | Protein_125 | transposase | - |
| JMX39_RS26055 | 118138..118308 | - | 171 | Protein_126 | LysR family transcriptional regulator | - |
| JMX39_RS26060 | 118433..118546 | + | 114 | WP_077252861.1 | IS3 family transposase | - |
| JMX39_RS26065 | 118638..120209 | - | 1572 | WP_049257520.1 | sensor domain-containing diguanylate cyclase | - |
| JMX39_RS26070 | 120607..121167 | - | 561 | Protein_129 | transposase | - |
| JMX39_RS26075 | 121202..122170 | - | 969 | WP_102097429.1 | IS5 family transposase | - |
| JMX39_RS26080 | 122188..122613 | - | 426 | WP_017901321.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMX39_RS26085 | 122610..122840 | - | 231 | WP_001261275.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| JMX39_RS26090 | 123093..125669 | - | 2577 | WP_017901322.1 | EstP | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pla | 1..226712 | 226712 | |
| - | flank | IS/Tn | - | - | 121202..122170 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15412.91 Da Isoelectric Point: 7.1364
>T290630 WP_017901321.1 NZ_LR890318:c122613-122188 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8A2Q2K1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A853H7M9 |