Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3559791..3560429 | Replicon | chromosome |
| Accession | NZ_LR890312 | ||
| Organism | Klebsiella oxytoca isolate MSB1_10D-sc-2280340 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | JMX52_RS16695 | Protein ID | WP_074184706.1 |
| Coordinates | 3559791..3559979 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | JMX52_RS16700 | Protein ID | WP_064355814.1 |
| Coordinates | 3560025..3560429 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX52_RS16670 | 3555015..3555200 | - | 186 | WP_201621167.1 | hypothetical protein | - |
| JMX52_RS16675 | 3557763..3558038 | - | 276 | WP_201621037.1 | hypothetical protein | - |
| JMX52_RS16680 | 3558041..3558223 | - | 183 | Protein_3284 | glycoside hydrolase family 19 protein | - |
| JMX52_RS16685 | 3558755..3559294 | - | 540 | WP_201621038.1 | glycoside hydrolase family 108 protein | - |
| JMX52_RS16690 | 3559281..3559631 | - | 351 | WP_064355816.1 | phage holin family protein | - |
| JMX52_RS16695 | 3559791..3559979 | + | 189 | WP_074184706.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| JMX52_RS16700 | 3560025..3560429 | + | 405 | WP_064355814.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| JMX52_RS16705 | 3560486..3560707 | - | 222 | WP_201621039.1 | DNA gyrase subunit B | - |
| JMX52_RS16710 | 3560877..3561554 | - | 678 | WP_201621040.1 | antitermination protein | - |
| JMX52_RS16715 | 3561551..3561853 | - | 303 | WP_201621041.1 | DUF1364 domain-containing protein | - |
| JMX52_RS16720 | 3561850..3562449 | - | 600 | WP_201621042.1 | DUF1367 family protein | - |
| JMX52_RS16725 | 3562961..3563683 | - | 723 | WP_201621043.1 | ATP-binding protein | - |
| JMX52_RS16730 | 3563686..3564465 | - | 780 | WP_201621044.1 | helix-turn-helix domain-containing protein | - |
| JMX52_RS16735 | 3564478..3564921 | - | 444 | WP_201621045.1 | hypothetical protein | - |
| JMX52_RS16740 | 3564899..3565132 | - | 234 | WP_201621046.1 | transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3530385..3576219 | 45834 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 6844.09 Da Isoelectric Point: 11.6952
>T290608 WP_074184706.1 NZ_LR890312:3559791-3559979 [Klebsiella oxytoca]
MTSADLIKRLIADGWVKQRQSGSHITLIKPGVSRIITIPHPRKDSSKGVIRQAQEISGLKLL
MTSADLIKRLIADGWVKQRQSGSHITLIKPGVSRIITIPHPRKDSSKGVIRQAQEISGLKLL
Download Length: 189 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 15068.02 Da Isoelectric Point: 4.4937
>AT290608 WP_064355814.1 NZ_LR890312:3560025-3560429 [Klebsiella oxytoca]
MLYPLFIFKTESGYDGYFPDLDGCFFAGDTVEKAVKNAEQAFGQHMEVLTEQGQHVPAPSDPAFYLADPRLAEDGGFLAL
VELDPSKWETRAIKFNLTMPGNLLTAIDRFIEQNGQYKNRSAFLADLARRELAR
MLYPLFIFKTESGYDGYFPDLDGCFFAGDTVEKAVKNAEQAFGQHMEVLTEQGQHVPAPSDPAFYLADPRLAEDGGFLAL
VELDPSKWETRAIKFNLTMPGNLLTAIDRFIEQNGQYKNRSAFLADLARRELAR
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|