Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 122319..122745 | Replicon | plasmid 2 |
| Accession | NZ_LR890300 | ||
| Organism | Escherichia coli isolate MSB1_3B-sc-2280406 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | JM188_RS25265 | Protein ID | WP_001312861.1 |
| Coordinates | 122319..122477 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 122521..122745 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JM188_RS25230 | 117431..117658 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| JM188_RS25235 | 117746..118423 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| JM188_RS25240 | 118557..118940 | - | 384 | WP_001151566.1 | relaxosome protein TraM | - |
| JM188_RS25245 | 119271..119873 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| JM188_RS25250 | 120170..120991 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| JM188_RS25255 | 121110..121397 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| JM188_RS25260 | 121422..121628 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| JM188_RS25265 | 122319..122477 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 122521..122745 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 122521..122745 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 122521..122745 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 122521..122745 | - | 225 | NuclAT_0 | - | Antitoxin |
| JM188_RS25270 | 122557..122745 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| JM188_RS25275 | 122757..123476 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| JM188_RS25280 | 123473..123907 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| JM188_RS25285 | 123962..125920 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
| JM188_RS25290 | 125986..126219 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| JM188_RS25295 | 126282..126821 | - | 540 | WP_000290841.1 | single-stranded DNA-binding protein | - |
| JM188_RS25300 | 127464..127694 | - | 231 | WP_021526513.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaTEM-1B / blaCTX-M-27 / erm(B) | senB | 1..160467 | 160467 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T290575 WP_001312861.1 NZ_LR890300:c122477-122319 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 225 bp
>AT290575 NZ_LR890300:c122745-122521 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|