Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 83040..83279 | Replicon | plasmid 2 |
| Accession | NZ_LR890300 | ||
| Organism | Escherichia coli isolate MSB1_3B-sc-2280406 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | JM188_RS25045 | Protein ID | WP_023144756.1 |
| Coordinates | 83040..83174 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 83219..83279 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JM188_RS25005 | 78387..78802 | - | 416 | Protein_96 | IS1 family transposase | - |
| JM188_RS25010 | 79051..79452 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| JM188_RS25015 | 79385..79642 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| JM188_RS25020 | 79735..80388 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| JM188_RS25025 | 81328..82185 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| JM188_RS25030 | 82178..82252 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| JM188_RS25035 | 82249..82383 | - | 135 | Protein_102 | protein CopA/IncA | - |
| JM188_RS25040 | 82489..82743 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| JM188_RS25045 | 83040..83174 | - | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 83219..83279 | + | 61 | NuclAT_1 | - | Antitoxin |
| - | 83219..83279 | + | 61 | NuclAT_1 | - | Antitoxin |
| - | 83219..83279 | + | 61 | NuclAT_1 | - | Antitoxin |
| - | 83219..83279 | + | 61 | NuclAT_1 | - | Antitoxin |
| JM188_RS25050 | 83246..83532 | - | 287 | Protein_105 | DUF2726 domain-containing protein | - |
| JM188_RS25055 | 84045..84257 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| JM188_RS25060 | 84388..84948 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| JM188_RS25065 | 85003..85749 | - | 747 | WP_000205725.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaTEM-1B / blaCTX-M-27 / erm(B) | senB | 1..160467 | 160467 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T290571 WP_023144756.1 NZ_LR890300:c83174-83040 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT290571 NZ_LR890300:83219-83279 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|