Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 2372868..2373557 | Replicon | chromosome |
| Accession | NZ_LR890240 | ||
| Organism | Klebsiella pneumoniae isolate INF329-sc-2280137 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A331C6E2 |
| Locus tag | JMV78_RS11580 | Protein ID | WP_021469727.1 |
| Coordinates | 2372868..2373185 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | JMV78_RS11585 | Protein ID | WP_040147778.1 |
| Coordinates | 2373261..2373557 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV78_RS11550 | 2368570..2369079 | + | 510 | WP_002906702.1 | GNAT family N-acetyltransferase | - |
| JMV78_RS11555 | 2369089..2370015 | + | 927 | WP_032416224.1 | amino acid ABC transporter permease | - |
| JMV78_RS11560 | 2369999..2370778 | + | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
| JMV78_RS11565 | 2370817..2371668 | + | 852 | WP_014343117.1 | transporter substrate-binding domain-containing protein | - |
| JMV78_RS11570 | 2371746..2372363 | + | 618 | WP_040147782.1 | glutathione S-transferase family protein | - |
| JMV78_RS11575 | 2372434..2372661 | + | 228 | WP_002906690.1 | tautomerase PptA | - |
| JMV78_RS11580 | 2372868..2373185 | + | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMV78_RS11585 | 2373261..2373557 | + | 297 | WP_040147778.1 | helix-turn-helix domain-containing protein | Antitoxin |
| JMV78_RS11590 | 2373636..2374082 | + | 447 | WP_004175959.1 | hypothetical protein | - |
| JMV78_RS11595 | 2374123..2375739 | - | 1617 | WP_040147777.1 | carbohydrate porin | - |
| JMV78_RS11600 | 2375783..2377165 | - | 1383 | WP_099743292.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T290379 WP_021469727.1 NZ_LR890240:2372868-2373185 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|