Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 9587..10188 Replicon plasmid 3
Accession NZ_LR890200
Organism Escherichia coli isolate MINF_1D-sc-2280456

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag JMV89_RS25030 Protein ID WP_001216045.1
Coordinates 9587..9967 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag JMV89_RS25035 Protein ID WP_072649184.1
Coordinates 9967..10188 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV89_RS25005 5027..6511 - 1485 WP_032333510.1 hypothetical protein -
JMV89_RS25010 6511..7704 - 1194 WP_000219605.1 terminase -
JMV89_RS25015 7791..8243 - 453 WP_032333508.1 Late promoter-activating protein -
JMV89_RS25020 8332..9375 - 1044 WP_000648827.1 DUF968 domain-containing protein -
JMV89_RS25025 9403..9582 - 180 WP_000113019.1 hypothetical protein -
JMV89_RS25030 9587..9967 - 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMV89_RS25035 9967..10188 - 222 WP_072649184.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMV89_RS25040 10261..10650 - 390 WP_000506726.1 DNA repair protein -
JMV89_RS25045 10774..11025 - 252 WP_001377386.1 DNA polymerase III subunit theta -
JMV89_RS25050 11475..11612 + 138 WP_000123562.1 hypothetical protein -
JMV89_RS25055 11687..12049 - 363 WP_001261544.1 hypothetical protein -
JMV89_RS25060 12046..12978 - 933 WP_000057449.1 hypothetical protein -
JMV89_RS25065 12960..13334 - 375 WP_000988658.1 hypothetical protein -
JMV89_RS25070 13341..13634 - 294 WP_001677496.1 hypothetical protein -
JMV89_RS25075 13813..14046 - 234 WP_000516537.1 hypothetical protein -
JMV89_RS25080 14129..15016 - 888 WP_063612277.1 DUF551 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..95734 95734


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T290272 WP_001216045.1 NZ_LR890200:c9967-9587 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8105.04 Da        Isoelectric Point: 4.7708

>AT290272 WP_072649184.1 NZ_LR890200:c10188-9967 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELANR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure

References