Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/- |
| Location | 3138887..3139109 | Replicon | chromosome |
| Accession | NC_020518 | ||
| Organism | Escherichia coli str. K-12 substr. MDS42 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1E8T8 |
| Locus tag | ECMDS42_RS15235 | Protein ID | WP_000141634.1 |
| Coordinates | 3138887..3138994 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3139043..3139109 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECMDS42_RS15210 (ECMDS42_2969) | 3134140..3134892 | - | 753 | Protein_2887 | cellulose biosynthesis protein BcsQ | - |
| ECMDS42_RS15215 (ECMDS42_2970) | 3134904..3135092 | - | 189 | WP_001063318.1 | cellulose biosynthesis protein BcsR | - |
| ECMDS42_RS15220 (ECMDS42_2971) | 3135365..3136936 | + | 1572 | WP_001204931.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| ECMDS42_RS15225 (ECMDS42_2972) | 3136933..3137124 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| ECMDS42_RS15230 (ECMDS42_2973) | 3137121..3138800 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
| ECMDS42_RS15235 (ECMDS42_2974) | 3138887..3138994 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
| - | 3139043..3139109 | + | 67 | - | - | Antitoxin |
| ECMDS42_RS15245 (ECMDS42_2976) | 3139470..3140741 | + | 1272 | WP_001295225.1 | aromatic amino acid transport family protein | - |
| ECMDS42_RS15250 (ECMDS42_2977) | 3140771..3141775 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| ECMDS42_RS15255 (ECMDS42_2978) | 3141772..3142755 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| ECMDS42_RS15260 (ECMDS42_2979) | 3142766..3143668 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T29017 WP_000141634.1 NC_020518:c3138994-3138887 [Escherichia coli str. K-12 substr. MDS42]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T29017 NC_020518:c3138994-3138887 [Escherichia coli str. K-12 substr. MDS42]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT29017 NC_020518:3139043-3139109 [Escherichia coli str. K-12 substr. MDS42]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|