Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4380226..4381024 | Replicon | chromosome |
| Accession | NZ_LR883050 | ||
| Organism | Escherichia coli isolate L1_E925 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | JL017_RS21385 | Protein ID | WP_001394823.1 |
| Coordinates | 4380647..4381024 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | JL017_RS21380 | Protein ID | WP_024169686.1 |
| Coordinates | 4380226..4380600 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JL017_RS21340 | 4376179..4376352 | - | 174 | Protein_4174 | transposase | - |
| JL017_RS21345 | 4376351..4376470 | + | 120 | Protein_4175 | AAA family ATPase | - |
| JL017_RS21350 | 4376520..4377608 | - | 1089 | Protein_4176 | ISL3 family transposase | - |
| JL017_RS21355 | 4377740..4377850 | + | 111 | Protein_4177 | DUF905 family protein | - |
| JL017_RS21360 | 4377951..4378769 | + | 819 | WP_001397454.1 | DUF945 domain-containing protein | - |
| JL017_RS21365 | 4378861..4379346 | + | 486 | WP_001397456.1 | antirestriction protein | - |
| JL017_RS21370 | 4379362..4379838 | + | 477 | WP_001186709.1 | RadC family protein | - |
| JL017_RS21375 | 4379925..4380146 | + | 222 | WP_000691818.1 | DUF987 domain-containing protein | - |
| JL017_RS21380 | 4380226..4380600 | + | 375 | WP_024169686.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| JL017_RS21385 | 4380647..4381024 | + | 378 | WP_001394823.1 | TA system toxin CbtA family protein | Toxin |
| JL017_RS21390 | 4381021..4381509 | + | 489 | WP_001394824.1 | hypothetical protein | - |
| JL017_RS21395 | 4381521..4381718 | + | 198 | WP_001394825.1 | DUF957 domain-containing protein | - |
| JL017_RS21400 | 4381803..4382645 | + | 843 | WP_001394826.1 | DUF4942 domain-containing protein | - |
| JL017_RS21405 | 4383456..4384994 | + | 1539 | WP_001187173.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4351010..4392811 | 41801 | |
| - | flank | IS/Tn | - | - | 4376712..4377596 | 884 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14206.19 Da Isoelectric Point: 8.2905
>T290160 WP_001394823.1 NZ_LR883050:4380647-4381024 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKR
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13862.66 Da Isoelectric Point: 6.3139
>AT290160 WP_024169686.1 NZ_LR883050:4380226-4380600 [Escherichia coli]
VSDTLHKTNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFLLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHKTNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFLLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|