Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 790081..790879 | Replicon | chromosome |
| Accession | NZ_LR883006 | ||
| Organism | Escherichia coli isolate L5_E1779_ETEC | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | JL014_RS03800 | Protein ID | WP_000854733.1 |
| Coordinates | 790081..790458 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | JL014_RS03805 | Protein ID | WP_032190265.1 |
| Coordinates | 790505..790879 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JL014_RS03775 | 785973..786509 | + | 537 | WP_000942799.1 | GspM family type II secretion system protein YghD | - |
| JL014_RS03780 | 786844..788379 | - | 1536 | WP_000484448.1 | EAL domain-containing protein | - |
| JL014_RS03785 | 788450..789298 | - | 849 | Protein_742 | DUF4942 domain-containing protein | - |
| JL014_RS03790 | 789387..789584 | - | 198 | WP_000839243.1 | DUF957 domain-containing protein | - |
| JL014_RS03795 | 789596..790084 | - | 489 | WP_000761663.1 | hypothetical protein | - |
| JL014_RS03800 | 790081..790458 | - | 378 | WP_000854733.1 | TA system toxin CbtA family protein | Toxin |
| JL014_RS03805 | 790505..790879 | - | 375 | WP_032190265.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| JL014_RS03810 | 790929..791573 | - | 645 | WP_000086771.1 | hypothetical protein | - |
| JL014_RS03815 | 791592..791813 | - | 222 | WP_000692327.1 | DUF987 domain-containing protein | - |
| JL014_RS03820 | 791876..792352 | - | 477 | WP_001502867.1 | RadC family protein | - |
| JL014_RS03825 | 792368..792841 | - | 474 | WP_001355870.1 | antirestriction protein | - |
| JL014_RS03830 | 792910..793179 | - | 270 | WP_001183319.1 | hypothetical protein | - |
| JL014_RS03835 | 793179..794009 | - | 831 | WP_024172271.1 | DUF945 domain-containing protein | - |
| JL014_RS03840 | 794024..795595 | - | 1572 | WP_000381395.1 | IS66 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14236.21 Da Isoelectric Point: 6.8528
>T290094 WP_000854733.1 NZ_LR883006:c790458-790081 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13967.80 Da Isoelectric Point: 6.7388
>AT290094 WP_032190265.1 NZ_LR883006:c790879-790505 [Escherichia coli]
VSDKLHETNYPDDHNDRIWWGLPCTVTPCFGARLVQEGNRLHYLANRAGIRGRFRDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADSLGSCGYVYMAVYPTLAPATTS
VSDKLHETNYPDDHNDRIWWGLPCTVTPCFGARLVQEGNRLHYLANRAGIRGRFRDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADSLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|