Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/-
Location 1075131..1075353 Replicon chromosome
Accession NC_020518
Organism Escherichia coli str. K-12 substr. MDS42

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag ECMDS42_RS05180 Protein ID WP_000170963.1
Coordinates 1075131..1075238 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1075286..1075353 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECMDS42_RS05150 (ECMDS42_0998) 1070440..1071522 + 1083 WP_000804726.1 peptide chain release factor 1 -
ECMDS42_RS05155 (ECMDS42_0999) 1071522..1072355 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
ECMDS42_RS05160 (ECMDS42_1000) 1072352..1072744 + 393 WP_000200374.1 invasion regulator SirB2 -
ECMDS42_RS05165 (ECMDS42_1001) 1072748..1073557 + 810 WP_001257044.1 invasion regulator SirB1 -
ECMDS42_RS05170 (ECMDS42_1002) 1073593..1074447 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
ECMDS42_RS05175 (ECMDS42_1003) 1074596..1074703 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
ECMDS42_RS05180 (ECMDS42_1005) 1075131..1075238 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1075286..1075353 + 68 - - Antitoxin
ECMDS42_RS05185 (ECMDS42_1007) 1075666..1075773 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
ECMDS42_RS05190 (ECMDS42_1009) 1076177..1077277 - 1101 WP_015439377.1 sodium-potassium/proton antiporter ChaA -
ECMDS42_RS05195 (ECMDS42_1010) 1077547..1077777 + 231 WP_001146444.1 putative cation transport regulator ChaB -
ECMDS42_RS05200 (ECMDS42_1011) 1077935..1078630 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
ECMDS42_RS05205 (ECMDS42_1012) 1078674..1079027 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T28999 WP_000170963.1 NC_020518:c1075238-1075131 [Escherichia coli str. K-12 substr. MDS42]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T28999 NC_020518:c1075238-1075131 [Escherichia coli str. K-12 substr. MDS42]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT28999 NC_020518:1075286-1075353 [Escherichia coli str. K-12 substr. MDS42]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References