Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2362067..2362762 | Replicon | chromosome |
| Accession | NZ_LR882496 | ||
| Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | JN993_RS10860 | Protein ID | WP_105799725.1 |
| Coordinates | 2362067..2362501 (-) | Length | 145 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TMN0 |
| Locus tag | JN993_RS10865 | Protein ID | WP_003410814.1 |
| Coordinates | 2362508..2362762 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN993_RS10850 | 2358221..2361262 | + | 3042 | WP_003899171.1 | DEAD/DEAH box helicase | - |
| JN993_RS10855 | 2361255..2362088 | + | 834 | WP_003899172.1 | SWIM zinc finger family protein | - |
| JN993_RS10860 | 2362067..2362501 | - | 435 | WP_105799725.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JN993_RS10865 | 2362508..2362762 | - | 255 | WP_003410814.1 | antitoxin | Antitoxin |
| JN993_RS10870 | 2362778..2363035 | - | 258 | WP_003410816.1 | hypothetical protein | - |
| JN993_RS10875 | 2363983..2364279 | + | 297 | WP_003410820.1 | PE family protein | - |
| JN993_RS10880 | 2364335..2365066 | + | 732 | WP_003900467.1 | PPE family protein | - |
| JN993_RS10885 | 2365606..2366352 | - | 747 | WP_003901330.1 | proteasome subunit alpha | - |
| JN993_RS10890 | 2366349..2367224 | - | 876 | WP_003411023.1 | proteasome subunit beta | - |
| JN993_RS10895 | 2367221..2367415 | - | 195 | WP_003411026.1 | ubiquitin-like protein Pup | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15648.05 Da Isoelectric Point: 7.4681
>T289699 WP_105799725.1 NZ_LR882496:c2362501-2362067 [Mycobacterium tuberculosis variant microti]
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADIVARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADIVARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|