Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 1242566..1243134 Replicon chromosome
Accession NZ_LR882496
Organism Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole

Toxin (Protein)


Gene name vapC Uniprot ID G0TH08
Locus tag JN993_RS05855 Protein ID WP_003405865.1
Coordinates 1242760..1243134 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TH07
Locus tag JN993_RS05850 Protein ID WP_003405863.1
Coordinates 1242566..1242763 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN993_RS05830 1238607..1239245 - 639 WP_003898730.1 lipid droplet-associated protein -
JN993_RS05835 1239335..1240342 + 1008 WP_003405853.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
JN993_RS05840 1240359..1241342 - 984 WP_003898731.1 hypothetical protein -
JN993_RS05845 1241405..1242478 + 1074 WP_105799741.1 redox-regulated ATPase YchF -
JN993_RS05850 1242566..1242763 + 198 WP_003405863.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
JN993_RS05855 1242760..1243134 + 375 WP_003405865.1 type II toxin-antitoxin system VapC family toxin Toxin
JN993_RS05860 1243337..1244035 + 699 WP_003898733.1 hypothetical protein -
JN993_RS05865 1244153..1244338 + 186 WP_003901093.1 hypothetical protein -
JN993_RS05870 1244265..1244540 - 276 WP_003405867.1 hypothetical protein -
JN993_RS05875 1244783..1245106 + 324 WP_003405871.1 antibiotic biosynthesis monooxygenase -
JN993_RS05880 1245121..1245831 - 711 WP_003911399.1 hypothetical protein -
JN993_RS05885 1245853..1246062 + 210 WP_003911400.1 hypothetical protein -
JN993_RS05890 1246014..1246721 - 708 Protein_1161 adenylate/guanylate cyclase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-111)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13444.56 Da        Isoelectric Point: 5.1881

>T289681 WP_003405865.1 NZ_LR882496:1242760-1243134 [Mycobacterium tuberculosis variant microti]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS

Download         Length: 375 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 6973.03 Da        Isoelectric Point: 11.7327

>AT289681 WP_003405863.1 NZ_LR882496:1242566-1242763 [Mycobacterium tuberculosis variant microti]
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TH08

Antitoxin

Source ID Structure
AlphaFold DB G0TH07

References