Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 1242566..1243134 | Replicon | chromosome |
| Accession | NZ_LR882496 | ||
| Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TH08 |
| Locus tag | JN993_RS05855 | Protein ID | WP_003405865.1 |
| Coordinates | 1242760..1243134 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TH07 |
| Locus tag | JN993_RS05850 | Protein ID | WP_003405863.1 |
| Coordinates | 1242566..1242763 (+) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN993_RS05830 | 1238607..1239245 | - | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
| JN993_RS05835 | 1239335..1240342 | + | 1008 | WP_003405853.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
| JN993_RS05840 | 1240359..1241342 | - | 984 | WP_003898731.1 | hypothetical protein | - |
| JN993_RS05845 | 1241405..1242478 | + | 1074 | WP_105799741.1 | redox-regulated ATPase YchF | - |
| JN993_RS05850 | 1242566..1242763 | + | 198 | WP_003405863.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| JN993_RS05855 | 1242760..1243134 | + | 375 | WP_003405865.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JN993_RS05860 | 1243337..1244035 | + | 699 | WP_003898733.1 | hypothetical protein | - |
| JN993_RS05865 | 1244153..1244338 | + | 186 | WP_003901093.1 | hypothetical protein | - |
| JN993_RS05870 | 1244265..1244540 | - | 276 | WP_003405867.1 | hypothetical protein | - |
| JN993_RS05875 | 1244783..1245106 | + | 324 | WP_003405871.1 | antibiotic biosynthesis monooxygenase | - |
| JN993_RS05880 | 1245121..1245831 | - | 711 | WP_003911399.1 | hypothetical protein | - |
| JN993_RS05885 | 1245853..1246062 | + | 210 | WP_003911400.1 | hypothetical protein | - |
| JN993_RS05890 | 1246014..1246721 | - | 708 | Protein_1161 | adenylate/guanylate cyclase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13444.56 Da Isoelectric Point: 5.1881
>T289681 WP_003405865.1 NZ_LR882496:1242760-1243134 [Mycobacterium tuberculosis variant microti]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|