Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 7133..7734 Replicon plasmid 2
Accession NZ_LR882051
Organism Escherichia coli isolate 2016-02-324

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag IHP20_RS23040 Protein ID WP_001216034.1
Coordinates 7354..7734 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag IHP20_RS23035 Protein ID WP_001190712.1
Coordinates 7133..7354 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IHP20_RS23005 2264..2989 + 726 WP_000331736.1 MerR family transcriptional regulator -
IHP20_RS23010 3089..3499 + 411 WP_000750473.1 hydroxyisourate hydrolase -
IHP20_RS23015 3602..4561 + 960 WP_000208728.1 DUF523 and DUF1722 domain-containing protein -
IHP20_RS23020 4707..5795 + 1089 WP_000633445.1 AAA family ATPase -
IHP20_RS23025 5858..6562 - 705 WP_001067852.1 IS6-like element IS26 family transposase -
IHP20_RS23030 6625..6870 - 246 Protein_7 IS1 family transposase -
IHP20_RS23035 7133..7354 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
IHP20_RS23040 7354..7734 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
IHP20_RS23045 7739..7918 + 180 WP_001513661.1 hypothetical protein -
IHP20_RS23050 7946..8305 + 360 WP_072617413.1 pdcB -
IHP20_RS23055 8229..8642 + 414 Protein_12 DDE-type integrase/transposase/recombinase -
IHP20_RS23060 8592..8909 - 318 WP_001513659.1 hypothetical protein -
IHP20_RS23065 9137..10153 - 1017 WP_096252673.1 IS5-like element IS5 family transposase -
IHP20_RS23070 10361..11764 + 1404 WP_001373486.1 S-methylmethionine permease -
IHP20_RS23075 11751..12683 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qnrS1 / blaCTX-M-15 / blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / dfrA14 - 1..94955 94955
- inside IScluster/Tn - - 5858..14911 9053


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T289578 WP_001216034.1 NZ_LR882051:7354-7734 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT289578 WP_001190712.1 NZ_LR882051:7133-7354 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References