Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 3829165..3829858 | Replicon | chromosome |
| Accession | NZ_LR882050 | ||
| Organism | Escherichia coli isolate 2016-02-324 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | IHP20_RS18440 | Protein ID | WP_000415584.1 |
| Coordinates | 3829165..3829461 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | IHP20_RS18445 | Protein ID | WP_000650107.1 |
| Coordinates | 3829463..3829858 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IHP20_RS18405 | 3824253..3824567 | - | 315 | WP_000958598.1 | antibiotic biosynthesis monooxygenase | - |
| IHP20_RS18410 | 3824598..3825179 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| IHP20_RS18415 | 3825498..3825830 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
| IHP20_RS18420 | 3825876..3827225 | - | 1350 | WP_000673403.1 | two-component system sensor histidine kinase QseC | - |
| IHP20_RS18425 | 3827222..3827881 | - | 660 | WP_001221493.1 | two-component system response regulator QseB | - |
| IHP20_RS18430 | 3828033..3828425 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| IHP20_RS18435 | 3828478..3828960 | + | 483 | WP_000183505.1 | transcriptional regulator | - |
| IHP20_RS18440 | 3829165..3829461 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| IHP20_RS18445 | 3829463..3829858 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| IHP20_RS18450 | 3829991..3831598 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| IHP20_RS18455 | 3831736..3833994 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T289575 WP_000415584.1 NZ_LR882050:3829165-3829461 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT289575 WP_000650107.1 NZ_LR882050:3829463-3829858 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|