Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 50515..51176 | Replicon | chromosome |
| Accession | NZ_LR881936 | ||
| Organism | Enterobacter cancerogenus strain UPC1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | ENTER_RS00260 | Protein ID | WP_202561431.1 |
| Coordinates | 50778..51176 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | ENTER_RS00255 | Protein ID | WP_202561430.1 |
| Coordinates | 50515..50775 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ENTER_RS00225 | 45623..45937 | - | 315 | WP_042321291.1 | PTS sugar transporter subunit IIB | - |
| ENTER_RS00230 | 46229..47179 | + | 951 | WP_006177643.1 | LacI family transcriptional regulator | - |
| ENTER_RS00235 | 47274..47570 | - | 297 | WP_006177644.1 | hypothetical protein | - |
| ENTER_RS00240 | 47753..48172 | + | 420 | WP_006177646.1 | GNAT family N-acetyltransferase | - |
| ENTER_RS00245 | 48169..48816 | - | 648 | WP_006177647.1 | TetR/AcrR family transcriptional regulator | - |
| ENTER_RS00250 | 48910..50403 | + | 1494 | WP_202561429.1 | MFS transporter | - |
| ENTER_RS00255 | 50515..50775 | + | 261 | WP_202561430.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| ENTER_RS00260 | 50778..51176 | + | 399 | WP_202561431.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| ENTER_RS00265 | 51311..52111 | + | 801 | WP_202561432.1 | lipoprotein NlpA | - |
| ENTER_RS00270 | 52117..52797 | - | 681 | WP_202561433.1 | EAL domain-containing protein | - |
| ENTER_RS00275 | 52874..53494 | - | 621 | WP_102891870.1 | response regulator transcription factor | - |
| ENTER_RS00280 | 54067..54702 | + | 636 | WP_042321474.1 | response regulator transcription factor | - |
| ENTER_RS00285 | 54743..55807 | - | 1065 | WP_006177656.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14688.81 Da Isoelectric Point: 5.5081
>T289487 WP_202561431.1 NZ_LR881936:50778-51176 [Enterobacter cancerogenus]
MRHMLDTNMVSHLVRQHPEVVSQYSKIAPDDMCISSVTEAELLYGVAKKHSPKLKETILEFLKTITVCDWDSEAATTYGA
LRAAMEKRGNVMGDLDQLIAAHAISQGTTIVTNDRAFLMVQELSVEDWTHAA
MRHMLDTNMVSHLVRQHPEVVSQYSKIAPDDMCISSVTEAELLYGVAKKHSPKLKETILEFLKTITVCDWDSEAATTYGA
LRAAMEKRGNVMGDLDQLIAAHAISQGTTIVTNDRAFLMVQELSVEDWTHAA
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|