Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 1649955..1650180 Replicon chromosome
Accession NZ_LR878365
Organism Shigella flexneri 3a isolate 83

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag JMV05_RS08100 Protein ID WP_000813254.1
Coordinates 1649955..1650110 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 1650122..1650180 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV05_RS08045 1645243..1645590 - 348 WP_000631711.1 IS66 family insertion sequence element accessory protein TnpB -
JMV05_RS08050 1645587..1646261 - 675 WP_001088287.1 IS66-like element accessory protein TnpA -
JMV05_RS08055 1646360..1646575 - 216 WP_000839572.1 class II holin family protein -
JMV05_RS08080 1647371..1648086 - 716 Protein_1578 bacteriophage antitermination protein Q -
JMV05_RS08085 1648083..1648448 - 366 WP_000140020.1 RusA family crossover junction endodeoxyribonuclease -
JMV05_RS08090 1648449..1649507 - 1059 WP_025759819.1 DUF968 domain-containing protein -
JMV05_RS08095 1649509..1649787 - 279 WP_000929754.1 hypothetical protein -
JMV05_RS08100 1649955..1650110 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 1650122..1650180 + 59 - - Antitoxin
JMV05_RS08105 1650762..1651178 - 417 WP_005069274.1 hypothetical protein -
JMV05_RS08110 1651249..1651946 + 698 WP_223368647.1 IS1 family transposase -
JMV05_RS08115 1651961..1652290 + 330 Protein_1585 3'-5' exoribonuclease -
JMV05_RS08120 1652349..1652552 + 204 WP_025759339.1 DUF4224 domain-containing protein -
JMV05_RS08125 1652552..1653589 + 1038 WP_004974968.1 tyrosine-type recombinase/integrase -
JMV05_RS08135 1653800..1654597 + 798 WP_001325918.1 DgsA anti-repressor MtfA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - ipaH9.8 1622275..1700367 78092


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T289445 WP_000813254.1 NZ_LR878365:c1650110-1649955 [Shigella flexneri 3a]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT289445 NZ_LR878365:1650122-1650180 [Shigella flexneri 3a]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References