Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 4068180..4068818 | Replicon | chromosome |
Accession | NZ_LR778143 | ||
Organism | Escherichia coli isolate SC422 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | H1C98_RS19525 | Protein ID | WP_000813794.1 |
Coordinates | 4068642..4068818 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | H1C98_RS19520 | Protein ID | WP_001270285.1 |
Coordinates | 4068180..4068596 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C98_RS19500 | 4063332..4064273 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
H1C98_RS19505 | 4064274..4065287 | - | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
H1C98_RS19510 | 4065305..4066450 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
H1C98_RS19515 | 4066695..4068101 | - | 1407 | WP_000760594.1 | PLP-dependent aminotransferase family protein | - |
H1C98_RS19520 | 4068180..4068596 | - | 417 | WP_001270285.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
H1C98_RS19525 | 4068642..4068818 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
H1C98_RS19530 | 4069040..4069270 | + | 231 | WP_000494244.1 | YncJ family protein | - |
H1C98_RS19535 | 4069362..4071323 | - | 1962 | Protein_3812 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
H1C98_RS19540 | 4071396..4071932 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
H1C98_RS19545 | 4071985..4073199 | + | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4073239..4074387 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T289151 WP_000813794.1 NZ_LR778143:c4068818-4068642 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15247.61 Da Isoelectric Point: 4.6115
>AT289151 WP_001270285.1 NZ_LR778143:c4068596-4068180 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|