Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1865679..1866304 | Replicon | chromosome |
Accession | NZ_LR699010 | ||
Organism | Lachnoanaerobaculum umeaense isolate MGYG-HGUT-02522 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | FX093_RS08430 | Protein ID | WP_111525495.1 |
Coordinates | 1865679..1866080 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | FX093_RS08435 | Protein ID | WP_111525494.1 |
Coordinates | 1866077..1866304 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FX093_RS08410 | 1863363..1863668 | - | 306 | WP_111525499.1 | ribosomal L7Ae/L30e/S12e/Gadd45 family protein | - |
FX093_RS08415 | 1863655..1863939 | - | 285 | WP_111525498.1 | YlxR family protein | - |
FX093_RS08420 | 1863917..1865077 | - | 1161 | WP_111525497.1 | transcription termination/antitermination protein NusA | - |
FX093_RS08425 | 1865096..1865596 | - | 501 | WP_111525496.1 | ribosome maturation factor RimP | - |
FX093_RS08430 | 1865679..1866080 | - | 402 | WP_111525495.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
FX093_RS08435 | 1866077..1866304 | - | 228 | WP_111525494.1 | antitoxin | Antitoxin |
FX093_RS08440 | 1866426..1868177 | - | 1752 | WP_111525493.1 | DUF5050 domain-containing protein | - |
FX093_RS08445 | 1868196..1869986 | - | 1791 | WP_162902565.1 | YARHG domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15124.54 Da Isoelectric Point: 7.8637
>T288774 WP_111525495.1 NZ_LR699010:c1866080-1865679 [Lachnoanaerobaculum umeaense]
MRYMLDTNICIYIIKNNPDSVIEELKRHDPKEICISSITYAELIHGVEKSKAVGKNRLALTLFLSNIEVLDFDTNAANNY
GKIRAYLEKKGTLIGQLDMMIAAHAQSLGYSIVTNNIKEFTRVPDLTVYNWVK
MRYMLDTNICIYIIKNNPDSVIEELKRHDPKEICISSITYAELIHGVEKSKAVGKNRLALTLFLSNIEVLDFDTNAANNY
GKIRAYLEKKGTLIGQLDMMIAAHAQSLGYSIVTNNIKEFTRVPDLTVYNWVK
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|