Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 1332787..1333353 | Replicon | chromosome |
Accession | NZ_LR699003 | ||
Organism | Bifidobacterium breve isolate MGYG-HGUT-02469 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S2ZEY8 |
Locus tag | FX083_RS05980 | Protein ID | WP_014483710.1 |
Coordinates | 1333060..1333353 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0L7C7C8 |
Locus tag | FX083_RS05975 | Protein ID | WP_014483711.1 |
Coordinates | 1332787..1333056 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FX083_RS05950 | 1328537..1329232 | - | 696 | WP_015438830.1 | response regulator transcription factor | - |
FX083_RS05955 | 1329358..1329873 | + | 516 | WP_013140733.1 | hypothetical protein | - |
FX083_RS05960 | 1329870..1330760 | + | 891 | WP_015438831.1 | hypothetical protein | - |
FX083_RS05965 | 1330757..1331437 | + | 681 | WP_003829413.1 | ABC transporter ATP-binding protein | - |
FX083_RS05970 | 1331434..1332602 | + | 1169 | Protein_1107 | ABC transporter permease | - |
FX083_RS05975 | 1332787..1333056 | + | 270 | WP_014483711.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FX083_RS05980 | 1333060..1333353 | + | 294 | WP_014483710.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
FX083_RS05990 | 1334022..1334573 | + | 552 | WP_015438834.1 | RNA polymerase sigma factor | - |
FX083_RS05995 | 1334607..1335434 | + | 828 | WP_015438835.1 | hypothetical protein | - |
FX083_RS06000 | 1335566..1336192 | + | 627 | WP_015438836.1 | hypothetical protein | - |
FX083_RS06005 | 1336189..1336971 | + | 783 | WP_015438837.1 | hypothetical protein | - |
FX083_RS06010 | 1337023..1337898 | + | 876 | WP_015438838.1 | ABC transporter ATP-binding protein | - |
FX083_RS06015 | 1337952..1338350 | + | 399 | WP_015438839.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1326693..1352222 | 25529 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11188.96 Da Isoelectric Point: 9.7881
>T288723 WP_014483710.1 NZ_LR699003:1333060-1333353 [Bifidobacterium breve]
MLKPDYTAAFQRDIKKLKRKHADLRPLKEVIRLVLEDTADSKEVLRRRHRAHTLTGDLNGVLECHIGNAGDWLLLWIRDD
GTAMFMRTGSHDELLGK
MLKPDYTAAFQRDIKKLKRKHADLRPLKEVIRLVLEDTADSKEVLRRRHRAHTLTGDLNGVLECHIGNAGDWLLLWIRDD
GTAMFMRTGSHDELLGK
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S2ZEY8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0L7C7C8 |