Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/RelB(antitoxin) |
| Location | 1143815..1144451 | Replicon | chromosome |
| Accession | NZ_LR699003 | ||
| Organism | Bifidobacterium breve isolate MGYG-HGUT-02469 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | D4BP71 |
| Locus tag | FX083_RS05020 | Protein ID | WP_003829234.1 |
| Coordinates | 1143815..1144171 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | D6PAX1 |
| Locus tag | FX083_RS05025 | Protein ID | WP_012577921.1 |
| Coordinates | 1144158..1144451 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FX083_RS04990 | 1139003..1139914 | + | 912 | WP_015438746.1 | ABC transporter ATP-binding protein | - |
| FX083_RS04995 | 1140111..1140737 | + | 627 | WP_003829226.1 | 30S ribosomal protein S4 | - |
| FX083_RS05000 | 1141074..1141856 | - | 783 | WP_015438747.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
| FX083_RS05005 | 1141999..1142484 | - | 486 | WP_003829229.1 | cytidine deaminase | - |
| FX083_RS05010 | 1142575..1142931 | + | 357 | WP_003833231.1 | SdpI family protein | - |
| FX083_RS05015 | 1143036..1143638 | + | 603 | WP_003829233.1 | transglutaminase family protein | - |
| FX083_RS05020 | 1143815..1144171 | - | 357 | WP_003829234.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| FX083_RS05025 | 1144158..1144451 | - | 294 | WP_012577921.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| FX083_RS05030 | 1144602..1144766 | - | 165 | Protein_938 | IS30 family transposase | - |
| FX083_RS05035 | 1144866..1145540 | + | 675 | WP_015438748.1 | histidine phosphatase family protein | - |
| FX083_RS05040 | 1145623..1146027 | + | 405 | WP_003829238.1 | DUF948 domain-containing protein | - |
| FX083_RS05045 | 1146027..1146263 | + | 237 | WP_003829239.1 | hypothetical protein | - |
| FX083_RS05050 | 1146359..1149037 | + | 2679 | WP_003829240.1 | alanine--tRNA ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13316.23 Da Isoelectric Point: 7.9984
>T288722 WP_003829234.1 NZ_LR699003:c1144171-1143815 [Bifidobacterium breve]
MMKTDPHQFEIWWVPFTFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSSLFLDDGPTGRLSAYDAGRVTWAINELYPGLLA
MMKTDPHQFEIWWVPFTFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSSLFLDDGPTGRLSAYDAGRVTWAINELYPGLLA
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0L7B6G7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1S2VTZ6 |