Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1259912..1260581 | Replicon | chromosome |
| Accession | NZ_LR590465 | ||
| Organism | Haemophilus influenzae strain NCTC8468 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2R3G0F4 |
| Locus tag | FGK83_RS06265 | Protein ID | WP_015701504.1 |
| Coordinates | 1259912..1260295 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A502K5Z3 |
| Locus tag | FGK83_RS06270 | Protein ID | WP_005651224.1 |
| Coordinates | 1260279..1260581 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGK83_RS06230 | 1256672..1256995 | + | 324 | WP_114877442.1 | DUF2190 family protein | - |
| FGK83_RS06235 | 1256976..1257287 | + | 312 | WP_015701509.1 | hypothetical protein | - |
| FGK83_RS06240 | 1257290..1257820 | + | 531 | WP_015701508.1 | phage tail protein | - |
| FGK83_RS06245 | 1257829..1258239 | + | 411 | WP_112072217.1 | phage tail protein | - |
| FGK83_RS06250 | 1258242..1258892 | + | 651 | WP_112072216.1 | hypothetical protein | - |
| FGK83_RS06255 | 1259167..1259574 | + | 408 | WP_059358263.1 | hypothetical protein | - |
| FGK83_RS06260 | 1259619..1259843 | + | 225 | WP_038440708.1 | DUF4035 domain-containing protein | - |
| FGK83_RS06265 | 1259912..1260295 | + | 384 | WP_015701504.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| FGK83_RS06270 | 1260279..1260581 | + | 303 | WP_005651224.1 | XRE family transcriptional regulator | Antitoxin |
| FGK83_RS06275 | 1260597..1260833 | + | 237 | WP_101494098.1 | hypothetical protein | - |
| FGK83_RS06280 | 1260885..1264277 | + | 3393 | WP_138171923.1 | tape measure protein | - |
| FGK83_RS06285 | 1264274..1264600 | + | 327 | WP_112072214.1 | phage tail protein | - |
| FGK83_RS06290 | 1264600..1265313 | + | 714 | WP_138171924.1 | phage minor tail protein L | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1226936..1272929 | 45993 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14868.05 Da Isoelectric Point: 4.4987
>T288466 WP_015701504.1 NZ_LR590465:1259912-1260295 [Haemophilus influenzae]
MKQEWEVILQDPLLNWLETLAEDDVLKIYAALELLSTEGPQLSRPYADTLQGSKYTNLKELRVQSKLSVFRLFYIFDPVR
QAIVLCGGDKKGKKEKLFYKEMIALAEQTYDDYLSELTKEQENEREI
MKQEWEVILQDPLLNWLETLAEDDVLKIYAALELLSTEGPQLSRPYADTLQGSKYTNLKELRVQSKLSVFRLFYIFDPVR
QAIVLCGGDKKGKKEKLFYKEMIALAEQTYDDYLSELTKEQENEREI
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2R3G0F4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A502K5Z3 |