Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 214652..215177 Replicon plasmid 2
Accession NZ_LR213456
Organism Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332

Toxin (Protein)


Gene name ccdB Uniprot ID Q326Z8
Locus tag E0E35_RS25195 Protein ID WP_001159860.1
Coordinates 214652..214957 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q7BEK0
Locus tag E0E35_RS25200 Protein ID WP_000813626.1
Coordinates 214959..215177 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E35_RS25165 210680..210946 - 267 Protein_244 IS66 family insertion sequence element accessory protein TnpB -
E0E35_RS25170 211303..211893 - 591 WP_000705601.1 type III secretion system effector protein kinase OspG -
E0E35_RS26480 211976..212145 - 170 Protein_246 type II toxin-antitoxin system toxin YacB -
E0E35_RS25180 212145..212414 - 270 Protein_247 type II toxin-antitoxin system antitoxin YacA -
E0E35_RS25185 212622..214259 - 1638 WP_000936806.1 T3SS effector E3 ubiquitin-protein ligase IpaH9.8 -
E0E35_RS25195 214652..214957 - 306 WP_001159860.1 type II toxin-antitoxin system toxin CcdB Toxin
E0E35_RS25200 214959..215177 - 219 WP_000813626.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
E0E35_RS25205 215713..216666 - 954 Protein_251 IS66 family transposase -
E0E35_RS25210 216722..217419 + 698 WP_227804301.1 IS1 family transposase -
E0E35_RS25220 217645..217920 - 276 WP_000421262.1 type II toxin-antitoxin system RelE/ParE family toxin -
E0E35_RS25225 217920..218204 - 285 WP_011114774.1 ribbon-helix-helix domain-containing protein -
E0E35_RS25235 218656..218907 + 252 WP_001381727.1 transporter -
E0E35_RS25240 218957..219166 + 210 Protein_256 peptidoglycan-binding protein -
E0E35_RS25245 219266..219451 - 186 Protein_257 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH4.5 / ipaH7.8 / ospC2 / ipaH7.8 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospC2 / ospC4 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 / ospG / ipaH9.8 / ospI 1..234171 234171
- inside IScluster/Tn - ospG / ipaH9.8 / ospI 205558..229953 24395


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11736.59 Da        Isoelectric Point: 6.4674

>T288283 WP_001159860.1 NZ_LR213456:c214957-214652 [Shigella flexneri]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8333.36 Da        Isoelectric Point: 6.2838

>AT288283 WP_000813626.1 NZ_LR213456:c215177-214959 [Shigella flexneri]
MKQRITVTIDSDSYQLLKSANVNISGLVNTAMQKEARRLRAERWQAENQQGMAEIARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TTN3

Antitoxin

Source ID Structure
AlphaFold DB Q7BEK0

References