Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 744806..745533 | Replicon | chromosome |
Accession | NZ_LR213455 | ||
Organism | Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | E0E35_RS03770 | Protein ID | WP_000550189.1 |
Coordinates | 744806..745120 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | E0E35_RS03775 | Protein ID | WP_000560266.1 |
Coordinates | 745117..745533 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E35_RS03750 (740951) | 740951..741949 | - | 999 | WP_005050984.1 | Gfo/Idh/MocA family oxidoreductase | - |
E0E35_RS03755 (742028) | 742028..742720 | - | 693 | WP_000942538.1 | vancomycin high temperature exclusion protein | - |
E0E35_RS03760 (742797) | 742797..743300 | - | 504 | WP_005050988.1 | M48 family metallopeptidase | - |
E0E35_RS03765 (743385) | 743385..744521 | + | 1137 | WP_000018656.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
E0E35_RS03770 (744806) | 744806..745120 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
E0E35_RS03775 (745117) | 745117..745533 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
E0E35_RS03780 (745578) | 745578..747596 | - | 2019 | WP_000121487.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
E0E35_RS03785 (747822) | 747822..750173 | - | 2352 | WP_000695506.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T288266 WP_000550189.1 NZ_LR213455:744806-745120 [Shigella flexneri]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT288266 WP_000560266.1 NZ_LR213455:745117-745533 [Shigella flexneri]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|